Vasoactive intestinal peptide (VIP) 10mg Product Information
Vasoactive Intestinal Peptide (VIP) 10 mg research-grade lyophilized peptide powder in a glass vial. VIP is an endogenous neuropeptide studied in experimental models of vasodilation, smooth-muscle relaxation, pulmonary and gastrointestinal physiology, and neuroendocrine signaling. Research Use Only: All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use. Purity High-purity research grade Form Lyophilized peptide powder Content 10 mg VIP per vial Packaging Glass vial with sterile closure Storage Store lyophilized at 2–8 °C in a dry, desiccated place, protected from light. Molecular formula C147H237N43O43S Molecular weight ≈ 3323.8 g·mol⁻¹ Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 aa) CAS number 40077-57-4 In laboratory workflows, lyophilized research peptides are typically handled with suitable sterile diluents such as bacteriostatic water (BAC). For a compatible research-only solvent, see Bacteriostatic water – 10 ml . Research Overview VIP is a 28–amino acid neuropeptide used as a tool compound in vascular, pulmonary, gastrointestinal and neuroendocrine research. In experimental systems it is applied to probe VPAC1/VPAC2 receptor–mediated cAMP signaling, smooth-muscle relaxation, airway and vascular tone regulation, and broader immunomodulatory pathways in vitro and in vivo models. Primary Research Areas Vasodilation and vascular tone: Used to examine VIP receptor signaling (VPAC1/VPAC2) in regulation of vascular smooth-muscle relaxation and cAMP-dependent pathways. Pulmonary physiology and airway reactivity: Studied in models of airway smooth-muscle tone, bronchodilation and inflammatory signaling in pulmonary research. Gastrointestinal motility and secretion: Applied to investigate neuropeptidergic control of GI smooth-muscle motility, secretion and mucosal signaling. Neuroendocrine signaling and circadian regulation: Employed in studies of hypothalamic–pituitary axes, pineal/circadian signaling and broader neuropeptidergic communication. Immunomodulation and inflammatory pathways: Used in cellular models exploring VIP’s effects on cytokine profiles and immune-cell signaling networks.
