LL-37 5mg Product Information
LL-37 5 mg research-grade lyophilized peptide powder in a glass vial. LL-37 is the only known human cathelicidin antimicrobial peptide (hCAP18) and a key effector of the innate immune system, widely used in models of antimicrobial defense, biofilm disruption, wound healing and immunomodulation. Research Use Only: All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use. Purity High-purity research grade Form Lyophilized peptide powder Content 5 mg LL-37 per vial Appearance White to off-white powder Packaging Glass vial with sterile closure Storage Store lyophilized at 2–8 °C, desiccated and protected from light Sequence [LL-37, 37 aa] Molecular Formula C205H340N60O53 Molecular Weight ≈ 4493.3 g·mol⁻¹ CAS Number 154947-66-7 In laboratory workflows, lyophilized research peptides are typically handled with suitable sterile diluents such as bacteriostatic water (BAC). For a compatible research-only solvent, see Bacteriostatic water – 10 ml . Research Overview LL-37 is a 37–amino-acid fragment of the human cathelicidin precursor hCAP18 and a broad-spectrum antimicrobial peptide. In experimental systems it is used as a tool compound to study innate immune defense, host–pathogen interactions, barrier function and tissue repair. Primary Research Areas Innate immunity & antimicrobial activity: models exploring host defense against bacteria, viruses and fungi, including membrane disruption and pathogen killing. Biofilm disruption: in-vitro systems studying LL-37 effects on bacterial biofilms and persistence phenotypes. Wound-healing & barrier repair: keratinocyte and epithelial models focused on re-epithelialization, migration and tissue regeneration. Immunomodulation: investigations of chemotaxis, cytokine signaling and LL-37’s dual pro-/anti-inflammatory effects in immune-cell assays.
