LL-37 Product Information
LL-37 is a cationic, amphipathic research peptide derived from the cathelicidin family and encoded by the hCAP18 precursor, consisting of a 37–amino acid sequence that is widely examined in laboratory research for its role in host–microbe interaction models and innate immune–associated signaling frameworks. Due to its physicochemical properties, LL-37 is frequently included in studies investigating membrane-proximal interactions, peptide–lipid dynamics, and cellular interface signaling behavior in non-human experimental systems. In controlled research settings, LL-37 is explored for its interaction with pattern-recognition–adjacent receptor systems, including TLR-associated pathways and formyl-peptide–related signaling networks, allowing investigators to examine chemotactic signaling, cytokine-associated pathway regulation, and immune communication dynamics without implying applied or therapeutic outcomes. These models focus on signal coordination, pathway modulation, and cellular response patterns under experimentally defined conditions. LL-37 is also utilized in studies examining vascular-adjacent signaling, epithelial cell communication, and matrix-interface dynamics, where researchers analyze angiogenesis-associated pathway behavior and cell migration signaling frameworks in non-human models. Additional investigations evaluate LL-37 within endotoxin-associated signaling contexts, exploring how peptide–lipid interactions influence LPS-adjacent pathway activity and inflammatory signaling organization at the molecular level. Beyond immune-adjacent research, LL-37 is included in oncology-adjacent experimental models to assess how microenvironment-dependent signaling contexts influence cellular growth regulation, stress-response pathways, and signal plasticity. These studies emphasize context-specific pathway behavior rather than outcomes, contributing to a broader understanding of peptide-mediated signaling complexity in non-human research systems. Due to its diverse interaction profile and relevance across multiple signaling domains, LL-37 remains a widely studied compound in preclinical research focused on innate signaling architecture, host–microbe interface dynamics, and immune-associated pathway integration within strictly controlled laboratory environments. Summary of Characteristics Characteristic Details Chemical Sequence of Amino Acids LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRT Molecular Formula C205H340N60O53 Molecular Weight 4,493.32 g/mol: Other Known Titles LL-37 Research Peptide, Cathelicidin-Derived Peptide, hCAP18-Associated Research Peptide
