IGF-1 LR3 Product Information
IGF-1 LR3 – Research Grade Peptide IGF-1 LR3 is a modified analog of insulin-like growth factor-1 (IGF-1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF-binding proteins than native IGF-1, which may increase biological availability in research settings.[1][2] Product Details Synonyms: Long R3 IGF-1; IGF-1 LR3; Long Arg3 IGF-1 Peptide Type: IGF-1 analog Sequence: MFPAMPLLSLFVNARPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molecular Weight: 9117.60 g/mol CAS Number: 946870-92-4 Solubility: Soluble in water (typically provided as acetate salt); reconstitute in sterile water or dilute acetic acid For Research Use Only. This product is supplied for scientific research and laboratory use only, not for human or veterinary administration.
